CAV3 monoclonal antibody (M01), clone 1B9 View larger

CAV3 monoclonal antibody (M01), clone 1B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CAV3 monoclonal antibody (M01), clone 1B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CAV3 monoclonal antibody (M01), clone 1B9

Brand: Abnova
Reference: H00000859-M01
Product name: CAV3 monoclonal antibody (M01), clone 1B9
Product description: Mouse monoclonal antibody raised against a partial recombinant CAV3.
Clone: 1B9
Isotype: IgG2b Kappa
Gene id: 859
Gene name: CAV3
Gene alias: LGMD1C|LQT9|MGC126100|MGC126101|MGC126129|VIP-21|VIP21
Gene description: caveolin 3
Genbank accession: NM_001234
Immunogen: CAV3 (NP_001225, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP
Protein accession: NP_001225
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000859-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000859-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CAV3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CAV3 monoclonal antibody (M01), clone 1B9 now

Add to cart