CASQ2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

CASQ2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CASQ2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about CASQ2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000845-D01P
Product name: CASQ2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CASQ2 protein.
Gene id: 845
Gene name: CASQ2
Gene alias: FLJ26321|FLJ93514|PDIB2
Gene description: calsequestrin 2 (cardiac muscle)
Genbank accession: BC022288.1
Immunogen: CASQ2 (NP_001223.2, 1 a.a. ~ 399 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE
Protein accession: NP_001223.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000845-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CASQ2 expression in transfected 293T cell line (H00000845-T01) by CASQ2 MaxPab polyclonal antibody.

Lane 1: CASQ2 transfected lysate(46.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CASQ2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart