H00000843-M02_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000843-M02 |
Product name: | CASP10 monoclonal antibody (M02), clone 2E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CASP10. |
Clone: | 2E7 |
Isotype: | IgG2a Kappa |
Gene id: | 843 |
Gene name: | CASP10 |
Gene alias: | ALPS2|FLICE2|MCH4 |
Gene description: | caspase 10, apoptosis-related cysteine peptidase |
Genbank accession: | NM_032974 |
Immunogen: | CASP10 (NP_116756, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQ |
Protein accession: | NP_116756 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | CASP10 monoclonal antibody (M02), clone 2E7. Western Blot analysis of CASP10 expression in U-2 OS ( Cat # L022V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |