Brand: | Abnova |
Reference: | H00000843-A01 |
Product name: | CASP10 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CASP10. |
Gene id: | 843 |
Gene name: | CASP10 |
Gene alias: | ALPS2|FLICE2|MCH4 |
Gene description: | caspase 10, apoptosis-related cysteine peptidase |
Genbank accession: | NM_032974 |
Immunogen: | CASP10 (NP_116756, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQ |
Protein accession: | NP_116756 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CASP10 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of CASP10 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |