CASP3 monoclonal antibody (M02), clone 4D3 View larger

CASP3 monoclonal antibody (M02), clone 4D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CASP3 monoclonal antibody (M02), clone 4D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,PLA-Ce

More info about CASP3 monoclonal antibody (M02), clone 4D3

Brand: Abnova
Reference: H00000836-M02
Product name: CASP3 monoclonal antibody (M02), clone 4D3
Product description: Mouse monoclonal antibody raised against a partial recombinant CASP3.
Clone: 4D3
Isotype: IgG2a Kappa
Gene id: 836
Gene name: CASP3
Gene alias: CPP32|CPP32B|SCA-1
Gene description: caspase 3, apoptosis-related cysteine peptidase
Genbank accession: NM_004346
Immunogen: CASP3 (AAH16926.1, 176 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Protein accession: AAH16926.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000836-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged CASP3 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy CASP3 monoclonal antibody (M02), clone 4D3 now

Add to cart