Brand: | Abnova |
Reference: | H00000835-M10 |
Product name: | CASP2 monoclonal antibody (M10), clone 1C11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CASP2. |
Clone: | 1C11 |
Isotype: | IgG2a Kappa |
Gene id: | 835 |
Gene name: | CASP2 |
Gene alias: | CASP-2|ICH-1L|ICH-1L/1S|ICH1|NEDD2 |
Gene description: | caspase 2, apoptosis-related cysteine peptidase |
Genbank accession: | BC002427 |
Immunogen: | CASP2 (AAH02427, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRS |
Protein accession: | AAH02427 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to CASP2 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |