Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAPZB monoclonal antibody (M02), clone 1H1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about CAPZB monoclonal antibody (M02), clone 1H1
| Brand: | Abnova |
| Reference: | H00000832-M02 |
| Product name: | CAPZB monoclonal antibody (M02), clone 1H1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CAPZB. |
| Clone: | 1H1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 832 |
| Gene name: | CAPZB |
| Gene alias: | CAPB|CAPPB|CAPZ|MGC104401|MGC129749|MGC129750 |
| Gene description: | capping protein (actin filament) muscle Z-line, beta |
| Genbank accession: | NM_004930 |
| Immunogen: | CAPZB (NP_004921, 192 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC |
| Protein accession: | NP_004921 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CAPZB monoclonal antibody (M02), clone 1H1. Western Blot analysis of CAPZB expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |