Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAPZA1 polyclonal antibody (A02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CAPZA1 polyclonal antibody (A02)
| Brand: | Abnova |
| Reference: | H00000829-A02 |
| Product name: | CAPZA1 polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CAPZA1. |
| Gene id: | 829 |
| Gene name: | CAPZA1 |
| Gene alias: | CAPPA1|CAPZ|CAZ1 |
| Gene description: | capping protein (actin filament) muscle Z-line, alpha 1 |
| Genbank accession: | NM_006135 |
| Immunogen: | CAPZA1 (NP_006126, 82 a.a. ~ 170 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWN |
| Protein accession: | NP_006126 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CAPZA1 polyclonal antibody (A02), Lot # 060109JC01 Western Blot analysis of CAPZA1 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | HDAC2 and TXNL1 distinguish aneuploid from diploid colorectal cancers.Gemoll T, Roblick UJ, Szymczak S, Braunschweig T, Becker S, Igl BW, Bruch HP, Ziegler A, Hellman U, Difilippantonio MJ, Ried T, Jornvall H, Auer G, Habermann JK. Cell Mol Life Sci. 2011 Feb 3. [Epub ahead of print] |