Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAPNS1 monoclonal antibody (M01), clone 3C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about CAPNS1 monoclonal antibody (M01), clone 3C4
| Brand: | Abnova |
| Reference: | H00000826-M01 |
| Product name: | CAPNS1 monoclonal antibody (M01), clone 3C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CAPNS1. |
| Clone: | 3C4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 826 |
| Gene name: | CAPNS1 |
| Gene alias: | 30K|CALPAIN4|CANP|CANPS|CAPN4|CDPS |
| Gene description: | calpain, small subunit 1 |
| Genbank accession: | BC000592 |
| Immunogen: | CAPNS1 (AAH00592, 172 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE |
| Protein accession: | AAH00592 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CAPNS1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Vitamin E and C supplementation does not ameliorate muscle dysfunction following anterior cruciate ligament surgery.Barker T, Leonard SW, Hansen J, Trawick RH, Ingram R, Burdett G, Lebold KM, Walker JA, Traber MG. Free Radic Biol Med. 2009 Sep 11. [Epub ahead of print] |