Brand: | Abnova |
Reference: | H00000822-M02 |
Product name: | CAPG monoclonal antibody (M02), clone 6D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CAPG. |
Clone: | 6D6 |
Isotype: | IgG2a Kappa |
Gene id: | 822 |
Gene name: | CAPG |
Gene alias: | AFCP|MCP |
Gene description: | capping protein (actin filament), gelsolin-like |
Genbank accession: | NM_001747 |
Immunogen: | CAPG (NP_001738, 249 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK |
Protein accession: | NP_001738 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CAPG monoclonal antibody (M02), clone 6D6 Western Blot analysis of CAPG expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |