Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CANX monoclonal antibody (M08), clone 1D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about CANX monoclonal antibody (M08), clone 1D4
| Brand: | Abnova |
| Reference: | H00000821-M08 |
| Product name: | CANX monoclonal antibody (M08), clone 1D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CANX. |
| Clone: | 1D4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 821 |
| Gene name: | CANX |
| Gene alias: | CNX|FLJ26570|IP90|P90 |
| Gene description: | calnexin |
| Genbank accession: | NM_001746 |
| Immunogen: | CANX (NP_001737.1, 504 a.a. ~ 592 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE |
| Protein accession: | NP_001737.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CANX is approximately 1ng/ml as a capture antibody. |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | The SARS Coronavirus E Protein Interacts with PALS1 and Alters Tight Junction Formation and Epithelial Morphogenesis.Teoh KT, Siu YL, Chan WL, Schluter MA, Liu CJ, Peiris JS, Bruzzone R, Margolis B, Nal B. Mol Biol Cell. 2010 Nov;21(22):3838-52. Epub 2010 Sep 22. |