Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAMP purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about CAMP purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00000820-B02P |
| Product name: | CAMP purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CAMP protein. |
| Gene id: | 820 |
| Gene name: | CAMP |
| Gene alias: | CAP18|CRAMP|FALL-39|FALL39|HSD26|LL37 |
| Gene description: | cathelicidin antimicrobial peptide |
| Genbank accession: | NM_004345.3 |
| Immunogen: | CAMP (NP_004336.2, 1 a.a. ~ 170 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Protein accession: | NP_004336.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CAMP expression in transfected 293T cell line (H00000820-T02) by CAMP MaxPab polyclonal antibody. Lane 1: CAMP transfected lysate(18.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |