CAMLG monoclonal antibody (M02), clone 3F12 View larger

CAMLG monoclonal antibody (M02), clone 3F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CAMLG monoclonal antibody (M02), clone 3F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CAMLG monoclonal antibody (M02), clone 3F12

Brand: Abnova
Reference: H00000819-M02
Product name: CAMLG monoclonal antibody (M02), clone 3F12
Product description: Mouse monoclonal antibody raised against a partial recombinant CAMLG.
Clone: 3F12
Isotype: IgG2b Kappa
Gene id: 819
Gene name: CAMLG
Gene alias: CAML|MGC163197
Gene description: calcium modulating ligand
Genbank accession: NM_001745
Immunogen: CAMLG (NP_001736, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQG
Protein accession: NP_001736
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000819-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000819-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged CAMLG is approximately 1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CAMLG monoclonal antibody (M02), clone 3F12 now

Add to cart