Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAMK2B monoclonal antibody (M06), clone 6D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,ELISA,WB-Re |
More info about CAMK2B monoclonal antibody (M06), clone 6D6
| Brand: | Abnova |
| Reference: | H00000816-M06 |
| Product name: | CAMK2B monoclonal antibody (M06), clone 6D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CAMK2B. |
| Clone: | 6D6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 816 |
| Gene name: | CAMK2B |
| Gene alias: | CAM2|CAMK2|CAMKB|MGC29528 |
| Gene description: | calcium/calmodulin-dependent protein kinase II beta |
| Genbank accession: | NM_172081 |
| Immunogen: | CAMK2B (NP_742078, 405 a.a. ~ 502 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPL |
| Protein accession: | NP_742078 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to CAMK2B on HeLa cell. [antibody concentration 25 ug/ml] |
| Applications: | WB-Ce,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |