CALML3 purified MaxPab mouse polyclonal antibody (B02P) View larger

CALML3 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CALML3 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about CALML3 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00000810-B02P
Product name: CALML3 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human CALML3 protein.
Gene id: 810
Gene name: CALML3
Gene alias: CLP
Gene description: calmodulin-like 3
Genbank accession: NM_005185.2
Immunogen: CALML3 (NP_005176.1, 1 a.a. ~ 149 a.a) full-length human protein.
Immunogen sequence/protein sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Protein accession: NP_005176.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000810-B02P-13-15-1.jpg
Application image note: Western Blot analysis of CALML3 expression in transfected 293T cell line (H00000810-T01) by CALML3 MaxPab polyclonal antibody.

Lane 1: CALML3 transfected lysate(16.39 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CALML3 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart