Brand: | Abnova |
Reference: | H00000805-P01 |
Product name: | CALM2 (Human) Recombinant Protein (P01) |
Product description: | Human CALM2 full-length ORF ( AAH03354, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 805 |
Gene name: | CALM2 |
Gene alias: | CAMII|PHKD|PHKD2 |
Gene description: | calmodulin 2 (phosphorylase kinase, delta) |
Genbank accession: | BC003354 |
Immunogen sequence/protein sequence: | MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKVKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
Protein accession: | AAH03354 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Label-free detection of protein-protein interactions using a calmodulin-modified nanowire transistor.Lin TW, Hsieh PJ, Lin CL, Fang YY, Yang JX, Tsai CC, Chiang PL, Pan CY, Chen YT. Proc Natl Acad Sci U S A. 2010 Jan 19;107(3):1047-52. Epub 2009 Dec 23. |