Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CACNA1F polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CACNA1F polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000778-A01 |
| Product name: | CACNA1F polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CACNA1F. |
| Gene id: | 778 |
| Gene name: | CACNA1F |
| Gene alias: | AIED|COD3|CORDX|CORDX3|CSNB2|CSNB2A|CSNBX2|Cav1.4|JM8|JMC8|OA2 |
| Gene description: | calcium channel, voltage-dependent, L type, alpha 1F subunit |
| Genbank accession: | NM_005183 |
| Immunogen: | CACNA1F (NP_005174, 1878 a.a. ~ 1977 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL |
| Protein accession: | NP_005174 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Spontaneous and nicotine-induced Ca2+ oscillations mediated by Ca2+ influx in rat pinealocytes.Mizutani H, Yamamura H, Muramatsu M, Kiyota K, Nishimura K, Suzuki Y, Ohya S, Imaizumi Y Am J Physiol Cell Physiol. 2014 Jun 1;306(11):C1008-16. doi: 10.1152/ajpcell.00014.2014. Epub 2014 Apr 2. |