Brand: | Abnova |
Reference: | H00000775-A01 |
Product name: | CACNA1C polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CACNA1C. |
Gene id: | 775 |
Gene name: | CACNA1C |
Gene alias: | CACH2|CACN2|CACNL1A1|CCHL1A1|CaV1.2|MGC120730|TS |
Gene description: | calcium channel, voltage-dependent, L type, alpha 1C subunit |
Genbank accession: | NM_000719 |
Immunogen: | CACNA1C (NP_000710, 2039 a.a. ~ 2138 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | AVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL |
Protein accession: | NP_000710 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00000775-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00000775-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![H00000775-A01-2-92-1.jpg](http://www.abnova.com/application_image/H00000775-A01-2-92-1.jpg) |
Application image note: | CACNA1C polyclonal antibody (A01). Western Blot analysis of CACNA1C expression in rat testis. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |