CA12 MaxPab mouse polyclonal antibody (B01) View larger

CA12 MaxPab mouse polyclonal antibody (B01)

H00000771-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CA12 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about CA12 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00000771-B01
Product name: CA12 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CA12 protein.
Gene id: 771
Gene name: CA12
Gene alias: CAXII|FLJ20151|HsT18816
Gene description: carbonic anhydrase XII
Genbank accession: NM_001218.3
Immunogen: CA12 (NP_001209.1, 1 a.a. ~ 354 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Protein accession: NP_001209.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000771-B01-13-15-1.jpg
Application image note: Western Blot analysis of CA12 expression in transfected 293T cell line (H00000771-T01) by CA12 MaxPab polyclonal antibody.

Lane 1: CA12 transfected lysate(38.94 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CA12 MaxPab mouse polyclonal antibody (B01) now

Add to cart