Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00000770-B02 |
Product name: | CA11 MaxPab mouse polyclonal antibody (B02) |
Product description: | Mouse polyclonal antibody raised against a full-length human CA11 protein. |
Gene id: | 770 |
Gene name: | CA11 |
Gene alias: | CARP2|CARPX1 |
Gene description: | carbonic anhydrase XI |
Genbank accession: | NM_001217.3 |
Immunogen: | CA11 (NP_001208.2, 1 a.a. ~ 328 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR |
Protein accession: | NP_001208.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CA11 expression in transfected 293T cell line (H00000770-T02) by CA11 MaxPab polyclonal antibody. Lane 1: CA11 transfected lysate(36.08 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |