Brand: | Abnova |
Reference: | H00000761-A01 |
Product name: | CA3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant CA3. |
Gene id: | 761 |
Gene name: | CA3 |
Gene alias: | CAIII|Car3 |
Gene description: | carbonic anhydrase III, muscle specific |
Genbank accession: | BC004897 |
Immunogen: | CA3 (AAH04897, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWRPPQPINNRVVRASFK |
Protein accession: | AAH04897 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (54.71 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |