Brand: | Abnova |
Reference: | H00000759-A01 |
Product name: | CA1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant CA1. |
Gene id: | 759 |
Gene name: | CA1 |
Gene alias: | Car1 |
Gene description: | carbonic anhydrase I |
Genbank accession: | BC027890 |
Immunogen: | CA1 (AAH27890, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
Protein accession: | AAH27890 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (54.82 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | The human placental proteome is affected by maternal smoking.Huuskonen P, Amezaga MR, Bellingham M, Jones LH, Storvik M, Hakkinen M, Keski-Nisula L, Heinonen S, O'shaughnessy PJ, Fowler PA, Pasanen M. Reprod Toxicol. 2016 May 14. [Epub ahead of print] |