MPPED2 MaxPab mouse polyclonal antibody (B01) View larger

MPPED2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MPPED2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about MPPED2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00000744-B01
Product name: MPPED2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MPPED2 protein.
Gene id: 744
Gene name: MPPED2
Gene alias: 239FB|C11orf8|D11S302E|FAM1B|Hs.46638|dJ1024C24.1|dJ873F21.1
Gene description: metallophosphoesterase domain containing 2
Genbank accession: NM_001584
Immunogen: MPPED2 (NP_001575, 1 a.a. ~ 294 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
Protein accession: NP_001575
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00000744-B01-13-15-1.jpg
Application image note: Western Blot analysis of MPPED2 expression in transfected 293T cell line (H00000744-T01) by MPPED2 MaxPab polyclonal antibody.

Lane 1: MPPED2 transfected lysate(32.34 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MPPED2 MaxPab mouse polyclonal antibody (B01) now

Add to cart