C5R1 (Human) Recombinant Protein (Q01) View larger

C5R1 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C5R1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about C5R1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00000728-Q01
Product name: C5R1 (Human) Recombinant Protein (Q01)
Product description: Human C5R1 partial ORF ( AAH08982, 241 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 728
Gene name: C5AR1
Gene alias: C5A|C5AR|C5R1|CD88
Gene description: complement component 5a receptor 1
Genbank accession: BC008982
Immunogen sequence/protein sequence: LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNKLDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Protein accession: AAH08982
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000728-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy C5R1 (Human) Recombinant Protein (Q01) now

Add to cart