C4B polyclonal antibody (A02) View larger

C4B polyclonal antibody (A02)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C4B polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about C4B polyclonal antibody (A02)

Brand: Abnova
Reference: H00000721-A02
Product name: C4B polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a partial recombinant C4B.
Gene id: 721
Gene name: C4B
Gene alias: C4A|C4A13|C4A91|C4B1|C4B12|C4B2|C4B3|C4B5|C4F|CH|CO4|CPAMD3|FLJ60561|MGC164979
Gene description: complement component 4B (Chido blood group)
Genbank accession: NG_004658
Immunogen: C4B (NP_000343, 774 a.a. ~ 873 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: VRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVE
Protein accession: NP_000343
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000721-A02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy C4B polyclonal antibody (A02) now

Add to cart