Brand: | Abnova |
Reference: | H00000721-A02 |
Product name: | C4B polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant C4B. |
Gene id: | 721 |
Gene name: | C4B |
Gene alias: | C4A|C4A13|C4A91|C4B1|C4B12|C4B2|C4B3|C4B5|C4F|CH|CO4|CPAMD3|FLJ60561|MGC164979 |
Gene description: | complement component 4B (Chido blood group) |
Genbank accession: | NG_004658 |
Immunogen: | C4B (NP_000343, 774 a.a. ~ 873 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | VRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVE |
Protein accession: | NP_000343 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |