Brand: | Abnova |
Reference: | H00000718-M11 |
Product name: | C3 monoclonal antibody (M11), clone X1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C3. |
Clone: | X1 |
Isotype: | IgG2a Kappa |
Gene id: | 718 |
Gene name: | C3 |
Gene alias: | ARMD9|ASP|CPAMD1 |
Gene description: | complement component 3 |
Genbank accession: | NM_000064 |
Immunogen: | C3 (NP_000055, 1534 a.a. ~ 1644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK |
Protein accession: | NP_000055 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.95 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |