C1QC purified MaxPab mouse polyclonal antibody (B01P) View larger

C1QC purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1QC purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about C1QC purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00000714-B01P
Product name: C1QC purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human C1QC protein.
Gene id: 714
Gene name: C1QC
Gene alias: C1Q-C|C1QG|FLJ27103
Gene description: complement component 1, q subcomponent, C chain
Genbank accession: NM_172369
Immunogen: C1QC (NP_758957.2, 1 a.a. ~ 245 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Protein accession: NP_758957.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000714-B01P-13-15-1.jpg
Application image note: Western Blot analysis of C1QC expression in transfected 293T cell line (H00000714-T01) by C1QC MaxPab polyclonal antibody.

Lane 1: C1QG transfected lysate(26.95 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C1QC purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart