C1QA purified MaxPab rabbit polyclonal antibody (D01P) View larger

C1QA purified MaxPab rabbit polyclonal antibody (D01P)

H00000712-D01P_100ug

New product

384,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1QA purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about C1QA purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000712-D01P
Product name: C1QA purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human C1QA protein.
Gene id: 712
Gene name: C1QA
Gene alias: -
Gene description: complement component 1, q subcomponent, A chain
Genbank accession: NM_015991.2
Immunogen: C1QA (NP_057075.1, 1 a.a. ~ 245 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Protein accession: NP_057075.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000712-D01P-13-15-1.jpg
Application image note: Western Blot analysis of C1QA expression in transfected 293T cell line (H00000712-T03) by C1QA MaxPab polyclonal antibody.

Lane 1: C1QA transfected lysate(26.00 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C1QA purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart