BTC purified MaxPab rabbit polyclonal antibody (D01P) View larger

BTC purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BTC purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,PLA-Ce

More info about BTC purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000685-D01P
Product name: BTC purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human BTC protein.
Gene id: 685
Gene name: BTC
Gene alias: -
Gene description: betacellulin
Genbank accession: NM_001729
Immunogen: BTC (NP_001720.1, 1 a.a. ~ 178 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Protein accession: NP_001720.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000685-D01P-13-15-1.jpg
Application image note: Western Blot analysis of BTC expression in transfected 293T cell line (H00000685-T01) by BTC MaxPab polyclonal antibody.

Lane 1: BTC transfected lysate(19.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy BTC purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart