Brand: | Abnova |
Reference: | H00000667-A01 |
Product name: | DST polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant DST. |
Gene id: | 667 |
Gene name: | DST |
Gene alias: | BP240|BPA|BPAG1|CATX-15|D6S1101|DKFZp564B2416|DMH|DT|FLJ46791|KIAA0465|KIAA1470|MACF2 |
Gene description: | dystonin |
Genbank accession: | NM_183380 |
Immunogen: | DST (NP_899236, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS |
Protein accession: | NP_899236 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Evaluation of Contraceptive Potential of a Novel Epididymal Sperm Protein SFP2 in a Mouse Model.Khan SA, Jadhav SV, Suryawanshi AR, Bhonde GS, Gajbhiye RK, Khole VV. Am J Reprod Immunol. 2011 Jun 21. doi: 10.1111/j.1600-0897.2011.01030.x. |