BNIP3 purified MaxPab rabbit polyclonal antibody (D01P) View larger

BNIP3 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BNIP3 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about BNIP3 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000664-D01P
Product name: BNIP3 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human BNIP3 protein.
Gene id: 664
Gene name: BNIP3
Gene alias: NIP3
Gene description: BCL2/adenovirus E1B 19kDa interacting protein 3
Genbank accession: NM_004052
Immunogen: BNIP3 (NP_004043.2, 1 a.a. ~ 194 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF
Protein accession: NP_004043.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000664-D01P-13-15-1.jpg
Application image note: Western Blot analysis of BNIP3 expression in transfected 293T cell line (H00000664-T05) by BNIP3 MaxPab polyclonal antibody.

Lane 1: BNIP3 transfected lysate(21.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BNIP3 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart