Brand: | Abnova |
Reference: | H00000663-P01 |
Product name: | BNIP2 (Human) Recombinant Protein (P01) |
Product description: | Human BNIP2 full-length ORF ( AAH02461, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 663 |
Gene name: | BNIP2 |
Gene alias: | BNIP-2|NIP2 |
Gene description: | BCL2/adenovirus E1B 19kDa interacting protein 2 |
Genbank accession: | BC002461 |
Immunogen sequence/protein sequence: | MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ |
Protein accession: | AAH02461 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![qc_test-H00000663-P01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00000663-P01-1.jpg) |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Probing the efficiency of proteolytic events by positional proteomics.Plasman K, Van Damme P, Kaiserman D, Impens F, Demeyer K, Helsens K, Goethals M, Bird PI, Vandekerckhove J, Gevaert K. Mol Cell Proteomics. 2010 Nov 3. [Epub ahead of print] |