BNIP2 (Human) Recombinant Protein (P01) View larger

BNIP2 (Human) Recombinant Protein (P01)

H00000663-P01_10ug

New product

374,00 € tax excl.

10 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BNIP2 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about BNIP2 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00000663-P01
Product name: BNIP2 (Human) Recombinant Protein (P01)
Product description: Human BNIP2 full-length ORF ( AAH02461, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 663
Gene name: BNIP2
Gene alias: BNIP-2|NIP2
Gene description: BCL2/adenovirus E1B 19kDa interacting protein 2
Genbank accession: BC002461
Immunogen sequence/protein sequence: MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ
Protein accession: AAH02461
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000663-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Probing the efficiency of proteolytic events by positional proteomics.Plasman K, Van Damme P, Kaiserman D, Impens F, Demeyer K, Helsens K, Goethals M, Bird PI, Vandekerckhove J, Gevaert K.
Mol Cell Proteomics. 2010 Nov 3. [Epub ahead of print]

Reviews

Buy BNIP2 (Human) Recombinant Protein (P01) now

Add to cart