Brand: | Abnova |
Reference: | H00000661-M01 |
Product name: | POLR3D monoclonal antibody (M01), clone 4E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant POLR3D. |
Clone: | 4E6 |
Isotype: | IgG2a Kappa |
Gene id: | 661 |
Gene name: | POLR3D |
Gene alias: | BN51T|RPC4|RPC53|TSBN51 |
Gene description: | polymerase (RNA) III (DNA directed) polypeptide D, 44kDa |
Genbank accession: | BC000516 |
Immunogen: | POLR3D (-, 296 a.a. ~ 395 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH |
Protein accession: | - |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged POLR3D is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |