Brand: | Abnova |
Reference: | H00000660-M01 |
Product name: | BMX monoclonal antibody (M01), clone 3G3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BMX. |
Clone: | 3G3 |
Isotype: | IgG2b Kappa |
Gene id: | 660 |
Gene name: | BMX |
Gene alias: | ETK|PSCTK2|PSCTK3 |
Gene description: | BMX non-receptor tyrosine kinase |
Genbank accession: | BC016652 |
Immunogen: | BMX (AAH16652, 150 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP |
Protein accession: | AAH16652 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (40.15 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged BMX is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |