Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BMPR1B monoclonal antibody (M07), clone 2E2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about BMPR1B monoclonal antibody (M07), clone 2E2
| Brand: | Abnova |
| Reference: | H00000658-M07 |
| Product name: | BMPR1B monoclonal antibody (M07), clone 2E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BMPR1B. |
| Clone: | 2E2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 658 |
| Gene name: | BMPR1B |
| Gene alias: | ALK-6|ALK6|CDw293 |
| Gene description: | bone morphogenetic protein receptor, type IB |
| Genbank accession: | BC047773 |
| Immunogen: | BMPR1B (AAH47773.1, 24 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRA |
| Protein accession: | AAH47773.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |