BMP7 monoclonal antibody (M17), clone 1E10 View larger

BMP7 monoclonal antibody (M17), clone 1E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BMP7 monoclonal antibody (M17), clone 1E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about BMP7 monoclonal antibody (M17), clone 1E10

Brand: Abnova
Reference: H00000655-M17
Product name: BMP7 monoclonal antibody (M17), clone 1E10
Product description: Mouse monoclonal antibody raised against a full length recombinant BMP7.
Clone: 1E10
Isotype: IgG2a Kappa
Gene id: 655
Gene name: BMP7
Gene alias: OP-1
Gene description: bone morphogenetic protein 7
Genbank accession: NM_001719
Immunogen: BMP7 (NP_001710, 293 a.a. ~ 390 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPET
Protein accession: NP_001710
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy BMP7 monoclonal antibody (M17), clone 1E10 now

Add to cart