BMP5 (Human) Recombinant Protein (Q06) View larger

BMP5 (Human) Recombinant Protein (Q06)

New product

527,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BMP5 (Human) Recombinant Protein (Q06)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about BMP5 (Human) Recombinant Protein (Q06)

Brand: Abnova
Reference: H00000653-Q06
Product name: BMP5 (Human) Recombinant Protein (Q06)
Product description: Human BMP5 partial ORF (NP_066551.1, 341 a.a. - 454 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 653
Gene name: BMP5
Gene alias: MGC34244
Gene description: bone morphogenetic protein 5
Genbank accession: NM_021073.1
Immunogen sequence/protein sequence: VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
Protein accession: NP_066551.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00000653-Q06-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BMP5 (Human) Recombinant Protein (Q06) now

Add to cart