BMP3 (Human) Recombinant Protein (Q01) View larger

BMP3 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BMP3 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about BMP3 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00000651-Q01
Product name: BMP3 (Human) Recombinant Protein (Q01)
Product description: Human BMP3 partial ORF ( NP_001192, 373 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 651
Gene name: BMP3
Gene alias: BMP-3A
Gene description: bone morphogenetic protein 3
Genbank accession: NM_001201
Immunogen sequence/protein sequence: RYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Protein accession: NP_001192
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000651-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BMP3 (Human) Recombinant Protein (Q01) now

Add to cart