Brand: | Abnova |
Reference: | H00000633-P01 |
Product name: | BGN (Human) Recombinant Protein (P01) |
Product description: | Human BGN full-length ORF ( AAH02416.1, 1 a.a. - 368 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 633 |
Gene name: | BGN |
Gene alias: | DSPG1|PG-S1|PGI|SLRR1A |
Gene description: | biglycan |
Genbank accession: | BC002416 |
Immunogen sequence/protein sequence: | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
Protein accession: | AAH02416.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Regulation of PLAP-1 Expression in Periodontal Ligament Cells.Yamada S, Ozawa Y, Tomoeda M, Matoba R, Matsubara K, Murakami S. J Dent Res. 2006 May;85(5):447-51. |