Brand: | Abnova |
Reference: | H00000632-M01 |
Product name: | BGLAP monoclonal antibody (M01), clone 2D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BGLAP. |
Clone: | 2D4 |
Isotype: | IgG1 lambda |
Gene id: | 632 |
Gene name: | BGLAP |
Gene alias: | BGP|OC|PMF1 |
Gene description: | bone gamma-carboxyglutamate (gla) protein |
Genbank accession: | NM_199173 |
Immunogen: | BGLAP (NP_954642, 52 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
Protein accession: | NP_954642 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.13 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged BGLAP is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |