View larger

BAX (Human) Recombinant Protein (Q01)

Reference:

Condition: New product

Data sheet of BAX (Human) Recombinant Protein (Q01)

Brand:	Abnova
Reference:	H00000581-Q01
Product name:	BAX (Human) Recombinant Protein (Q01)
Product description:	Human BAX partial ORF ( NP_620116, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	581
Gene name:	BAX
Gene alias:	BCL2L4
Gene description:	BCL2-associated X protein
Genbank accession:	NM_138761
Immunogen sequence/protein sequence:	MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
Protein accession:	NP_620116
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Drp1 Mediates Caspase-Independent Type III Cell Death in Normal and Leukemic Cells.Bras M, Yuste VJ, Roue G, Barbier S, Sancho P, Virely C, Rubio M, Baudet S, Esquerda JE, Merle-Beral H, Sarfati M, Susin SA. Mol Cell Biol. 2007 Oct;27(20):7073-88. Epub 2007 Aug 6.