View larger

BAG1 (Human) Recombinant Protein (Q01)

Reference:

Condition: New product

Data sheet of BAG1 (Human) Recombinant Protein (Q01)

Brand:	Abnova
Reference:	H00000573-Q01
Product name:	BAG1 (Human) Recombinant Protein (Q01)
Product description:	Human BAG1 partial ORF ( NP_004314, 241 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	573
Gene name:	BAG1
Gene alias:	RAP46
Gene description:	BCL2-associated athanogene
Genbank accession:	NM_004323
Immunogen sequence/protein sequence:	EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
Protein accession:	NP_004314
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Co-chaperone potentiation of vitamin D receptor-mediated transactivation: a role for Bcl2-associated athanogene-1 as an intracellular-binding protein for 1,25-dihydroxyvitamin D3.Chun RF, Gacad M, Nguyen L, Hewison M, Adams JS. J Mol Endocrinol. 2007 Aug;39(2):81-9.