BAG1 monoclonal antibody (M02A), clone 2D3 View larger

BAG1 monoclonal antibody (M02A), clone 2D3

H00000573-M02A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BAG1 monoclonal antibody (M02A), clone 2D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about BAG1 monoclonal antibody (M02A), clone 2D3

Brand: Abnova
Reference: H00000573-M02A
Product name: BAG1 monoclonal antibody (M02A), clone 2D3
Product description: Mouse monoclonal antibody raised against a partial recombinant BAG1.
Clone: 2D3
Isotype: IgG2a Kappa
Gene id: 573
Gene name: BAG1
Gene alias: RAP46
Gene description: BCL2-associated athanogene
Genbank accession: NM_004323
Immunogen: BAG1 (NP_004314, 241 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
Protein accession: NP_004314
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000573-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00000573-M02A-1-6-1.jpg
Application image note: BAG1 monoclonal antibody (M02A), clone 2D3. Western Blot analysis of BAG1 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BAG1 monoclonal antibody (M02A), clone 2D3 now

Add to cart