Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BACH1 monoclonal antibody (M02), clone 1B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about BACH1 monoclonal antibody (M02), clone 1B8
| Brand: | Abnova |
| Reference: | H00000571-M02 |
| Product name: | BACH1 monoclonal antibody (M02), clone 1B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BACH1. |
| Clone: | 1B8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 571 |
| Gene name: | BACH1 |
| Gene alias: | - |
| Gene description: | BTB and CNC homology 1, basic leucine zipper transcription factor 1 |
| Genbank accession: | NM_206866 |
| Immunogen: | BACH1 (NP_996749, 396 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC |
| Protein accession: | NP_996749 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | BACH1 monoclonal antibody (M02), clone 1B8 Western Blot analysis of BACH1 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | RANKL induces Bach1 nuclear import and attenuates Nrf2-mediated antioxidant enzymes, thereby augmenting intracellular reactive oxygen species signaling and osteoclastogenesis in mice.Kanzaki H, Shinohara F, Itohiya K, Yamaguchi Y, Katsumata Y, Matsuzawa M, Fukaya S,Miyamoto Y, Wada S, Nakamura Y. FASEB J. 2016 Nov 11. [Epub ahead of print] |