Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of B2M monoclonal antibody (M01), clone 3F9-2C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab,PLA-Ce |
More info about B2M monoclonal antibody (M01), clone 3F9-2C2
| Brand: | Abnova |
| Reference: | H00000567-M01 |
| Product name: | B2M monoclonal antibody (M01), clone 3F9-2C2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant B2M. |
| Clone: | 3F9-2C2 |
| Isotype: | IgG2b kappa |
| Gene id: | 567 |
| Gene name: | B2M |
| Gene alias: | - |
| Gene description: | beta-2-microglobulin |
| Genbank accession: | BC032589 |
| Immunogen: | B2M (AAH32589, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM |
| Protein accession: | AAH32589 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to B2M on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | MHC-I expression renders catecholaminergic neurons susceptible to T-cell-mediated degeneration.Cebrian C, Zucca FA, Mauri P, Steinbeck JA, Studer L, Scherzer CR, Kanter E, Budhu S, Mandelbaum J, Vonsattel JP, Zecca L, Loike JD, Sulzer D Nat Commun. 2014 Apr 16;5:3633. doi: 10.1038/ncomms4633. |