Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00000552-M07A |
Product name: | AVPR1A monoclonal antibody (M07A), clone 7B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AVPR1A. |
Clone: | 7B8 |
Isotype: | IgG1 Kappa |
Gene id: | 552 |
Gene name: | AVPR1A |
Gene alias: | AVPR1 |
Gene description: | arginine vasopressin receptor 1A |
Genbank accession: | NM_000706 |
Immunogen: | AVPR1A (NP_000697, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAK |
Protein accession: | NP_000697 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (31.46 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of AVPR1A expression in transfected 293T cell line by AVPR1A monoclonal antibody (M07A), clone 7B8. Lane 1: AVPR1A transfected lysate(46.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |