Brand: | Abnova |
Reference: | H00000546-M01 |
Product name: | ATRX monoclonal antibody (M01), clone 3C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATRX. |
Clone: | 3C9 |
Isotype: | IgG1 Kappa |
Gene id: | 546 |
Gene name: | ATRX |
Gene alias: | ATR2|MGC2094|MRXHF1|RAD54|RAD54L|SFM1|SHS|XH2|XNP|ZNF-HX |
Gene description: | alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) |
Genbank accession: | NM_000489 |
Immunogen: | ATRX (NP_000480, 2311 a.a. ~ 2410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILM |
Protein accession: | NP_000480 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ATRX is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |