ATR monoclonal antibody (M03), clone 1E9 View larger

ATR monoclonal antibody (M03), clone 1E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATR monoclonal antibody (M03), clone 1E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA

More info about ATR monoclonal antibody (M03), clone 1E9

Brand: Abnova
Reference: H00000545-M03
Product name: ATR monoclonal antibody (M03), clone 1E9
Product description: Mouse monoclonal antibody raised against a partial recombinant ATR.
Clone: 1E9
Isotype: IgG1 Kappa
Gene id: 545
Gene name: ATR
Gene alias: FRP1|MEC1|SCKL|SCKL1
Gene description: ataxia telangiectasia and Rad3 related
Genbank accession: NM_001184
Immunogen: ATR (NP_001175, 2545 a.a. ~ 2644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
Protein accession: NP_001175
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000545-M03-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ATR on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: IHC-P,ELISA
Shipping condition: Dry Ice

Reviews

Buy ATR monoclonal antibody (M03), clone 1E9 now

Add to cart