ATP7B monoclonal antibody (M02), clone 3A12 View larger

ATP7B monoclonal antibody (M02), clone 3A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP7B monoclonal antibody (M02), clone 3A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ATP7B monoclonal antibody (M02), clone 3A12

Brand: Abnova
Reference: H00000540-M02
Product name: ATP7B monoclonal antibody (M02), clone 3A12
Product description: Mouse monoclonal antibody raised against a partial recombinant ATP7B.
Clone: 3A12
Isotype: IgG1 Kappa
Gene id: 540
Gene name: ATP7B
Gene alias: PWD|WC1|WD|WND
Gene description: ATPase, Cu++ transporting, beta polypeptide
Genbank accession: NM_000053
Immunogen: ATP7B (NP_000044, 1372 a.a. ~ 1465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
Protein accession: NP_000044
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000540-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000540-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ATP7B is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATP7B monoclonal antibody (M02), clone 3A12 now

Add to cart