Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATP7B monoclonal antibody (M01), clone 3E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about ATP7B monoclonal antibody (M01), clone 3E10
| Brand: | Abnova |
| Reference: | H00000540-M01 |
| Product name: | ATP7B monoclonal antibody (M01), clone 3E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP7B. |
| Clone: | 3E10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 540 |
| Gene name: | ATP7B |
| Gene alias: | PWD|WC1|WD|WND |
| Gene description: | ATPase, Cu++ transporting, beta polypeptide |
| Genbank accession: | NM_000053 |
| Immunogen: | ATP7B (NP_000044, 1372 a.a. ~ 1465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI |
| Protein accession: | NP_000044 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ATP7B is approximately 0.3ng/ml as a capture antibody. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Characterization of Sandwich-Cultured Hepatocytes as an In Vitro Model to Assess the Hepatobiliary Disposition of Copper.Ansede JH, Wright MR, St Claire RL, Hart RW, Gefroh HA, Brouwer KR. Drug Metab Dispos. 2009 May;37(5):969-76. Epub 2009 Feb 23. |